PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy021383
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 244aa    MW: 26870.6 Da    PI: 9.1815
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S58471771PU_refUnigeneView CDS
PUT-171a-Arachis_hypogaea-13773PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1023.4e-3271129159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy WrKYGqK+vkg++++rsYY+Ct +gC+v+k+ver+a+d k v++tYeg+Hnh+
  Ahy021383  71 LDDGYGWRKYGQKVVKGNPNARSYYKCTAPGCSVRKHVERAATDIKSVITTYEGKHNHD 129
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521723.7E-6560IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.5E-6839No hitNo description
Gene3DG3DSA:2.20.25.808.4E-3656131IPR003657WRKY domain
SuperFamilySSF1182907.06E-2863131IPR003657WRKY domain
PROSITE profilePS5081136.26566131IPR003657WRKY domain
SMARTSM007741.3E-3471130IPR003657WRKY domain
PfamPF031063.6E-2472129IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MVVSHVMEWR GLRVLVVDDD PTWLRILEKM LKKCSYEGXG ESEHDGHSAY GSRTVREPRV  60
VVQTTSEIDI LDDGYGWRKY GQKVVKGNPN ARSYYKCTAP GCSVRKHVER AATDIKSVIT  120
TYEGKHNHDV PAARGSAGYN MNRNSLNRNN SSAPAAPIRP AAVNGYSSAP NFTNSLYNPR  180
LPATGTQESS SLDMLQGSGL FGYTSLGRST GSYGNNSQLS DGVYIKAKDE RKDDSFLESF  240
LSKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-3962132878Probable WRKY transcription factor 4
2lex_A1e-3962132878Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015971606.11e-124PREDICTED: probable WRKY transcription factor 33
RefseqXP_016162334.11e-123PREDICTED: probable WRKY transcription factor 33
SwissprotQ8S8P59e-55WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLB3Y0141e-106B3Y014_SESRO; Transcription factor (Fragment)
STRINGGLYMA18G44030.12e-97(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.15e-48WRKY DNA-binding protein 33